toonpool logo
  • Agent
  • Collezioni
  • altro
    • Community
    • Membri
    • Cerca (Pro)
    • Aiuto
  • accedi




    • Password lost?
  • Registrati
  • italiano
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Più recenti vignette
Cartoon: 20210508-Inzidenz (medium) by Marcus Gottfried tagged inzidenz,inzidenzwert,corona,covid,spahn,infektion,börse,kurse,gewinn,verlust,aktien,wert,wertpapier,physik,mechanik,inzidenz,inzidenzwert,corona,covid,spahn,infektion,börse,kurse,gewinn,verlust,aktien,wert,wertpapier,physik,mechanik

20210508-Inzidenz

#384391 / visualizzato 2970 volte
Marcus Gottfried di Marcus Gottfried
il 23 May 2021
rating-star 3
Applause
favorite
Preferito
report spam
Segnalare

.

Politica

inzidenzinzidenzwertcoronacovidspahninfektionbörsekursegewinnverlustaktienwertwertpapierphysikmechanikinzidenzinzidenzwertcoronacovidspahninfektionbörsekursegewinnverlustaktienwertwertpapierphysikmechanik

Commenti (2)

 
RABE
Member
Höhere Töchterschule*****

RABE, il 24 May 2021  segnala post  rispondi applause 0

 
Harm Bengen
Member
füsick!

Harm Bengen, il 24 May 2021  segnala post  rispondi applause 0

 
 

Aggiungi un commento
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Altro di Marcus Gottfried


Cartoon: Sitzung (small) by Marcus Gottfried tagged afd,petry,bundestagswahl,merkel,plenum,plenarsaal,regierung,streit,austritt,feinde,fraktion,freunde,marcus,gottfried,cartoon,karikatur
Sitzung
Cartoon: Modell Bayreuth (small) by Marcus Gottfried tagged bayreuth,festspiele,bayern,merkel,wagner,stuhl,defekt,ohnmacht,bruch,zusammenbruch,irrtum,genuss,marcus,gottfried,cartoon,karikatur
Modell Bayreuth
Cartoon: 20210427-TestenLassen (small) by Marcus Gottfried tagged corona,covid,test,infektion,pcr,antigen,baumarkt,lockdown,click,an,meet
20210427-TestenLassen
  • Service

  • ToonAgent
  • Aiuto
  • FAQ
  • Daily Toon
  • Informazioni generali

  • Informazioni generali
  • Contatti
  • Termini d'Uso
  • Politica della Privacy
  • Manage cookies
  • Community

  • Community
  • Cerca (Pro)
  • Collezioni
  • Registrati
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.