toonpool logo
  • Agent
  • Collezioni
  • altro
    • Community
    • Membri
    • Cerca (Pro)
    • Aiuto
  • accedi




    • Password lost?
  • Registrati
  • italiano
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Più recenti vignette
Cartoon: Beaver hunt (medium) by KI-Vossy tagged beaver,beavers,biber,britain,norfolk,england,wildlife,camera,kamera,pensthorpe,rodent,trunks,lodge,nigel,farage,vermin,beaver,beavers,biber,britain,norfolk,england,wildlife,camera,kamera,pensthorpe,rodent,trunks,lodge,nigel,farage,vermin

Beaver hunt

#475199 / visualizzato 1852 volte
KI-Vossy di KI-Vossy
il 07 December 2025
rating-star 4
Applause
favorite
Preferito
report spam
Segnalare

For the first time since beavers were eradicated in Great Britain at the beginning of the 16th century, a wild beaver has been spotted in Norfolk. A wildlife camera at Pensthorpe Natural Park filmed the rodent a few weeks ago dragging tree trunks and building a beaver lodge.

This will certainly not please everyone.

Natura »  Environment  Evolution  Animals  Endangered Animals  Plants  Planet Earth  Seas & Oceans  Discoveries  Nature Protection  Ecological Destruction  Human

beaverbeaversbiberbritainnorfolkenglandwildlifecamerakamerapensthorperodenttrunkslodgenigelfarageverminbeaverbeaversbiberbritainnorfolkenglandwildlifecamerakamerapensthorperodenttrunkslodgenigelfaragevermin

Collections

(1)
Global warming

Commenti (2)

 
KI-Vossy
Member
MorituruS wrote:
It has long been clear that beavers are not vermins.
yes, but not for nigel!

KI-Vossy, il 07 December 2025  segnala post  rispondi applause 0

 
MorituruS
Member
It has long been clear that beavers are not vermins. The real vermins are others.

MorituruS, il 07 December 2025  segnala post  rispondi applause 0

 
 

Aggiungi un commento
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Altro di KI-Vossy


Cartoon: Don the Decorator (small) by KI-Vossy tagged republikaner,hakenkreuz,taylor,flagge,usa,washington,trump,republicans,meeting,flag,us,swastika,motif,republican,cross,right,wing,politiker,weiße,haus,decoration,decorations,decorator,paint,brown,potus
Don the Decorator
Cartoon: KI-Dildo (small) by KI-Vossy tagged ki,ai,sex,sildo,masturbieren,masturbation,chatbot,chatbots,chatgpt,flirt,flirts,sexuell,porno,pornos,pornoindustrie,vibrator
KI-Dildo
Cartoon: End of civilization (small) by KI-Vossy tagged trump,potus,usa,krieg,iran,medien,zivilisation,vernichtung,waffenstillstand,hormus,kriegsverbrechen,kriegsverbrecher,alien,us,president,destroy,civilization,end,ende,ceasefire,war,crime
End of civilization
  • Service

  • ToonAgent
  • Aiuto
  • FAQ
  • Daily Toon
  • Informazioni generali

  • Informazioni generali
  • Contatti
  • Termini d'Uso
  • Politica della Privacy
  • Manage cookies
  • Community

  • Community
  • Cerca (Pro)
  • Collezioni
  • Registrati
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.