toonpool logo
  • Agent
  • Collezioni
  • altro
    • Community
    • Membri
    • Cerca (Pro)
    • Aiuto
  • accedi




    • Password lost?
  • Registrati
  • italiano
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Più recenti vignette
Cartoon: Berufsorientierung (medium) by RABE tagged berufsorientierung,berufswahl,ausbildung,ausbildungsplatz,schule,unterricht,lehrer,lehrerin,schüler,schülerin,klassenraum,klasse,schultafel,nagel,nagelstudio,nagelbett,nagelverlängerung,nagellack,nagelpflege,kosmetik,kosmetikstudio,mädchen,maniküre,bildungsministerium,bildungsministerin,schavan,pisastudie,schulsystem,berufsorientierung,berufswahl,ausbildung,ausbildungsplatz,schule,unterricht,lehrer,lehrerin,klasse,klassenraum,schülerin,schüler,kosmetikstudio,kosmetik,nagelpflege,nagellack,nagelverlängerung,maniküre,bildun,mädchen,job,arbeit

Berufsorientierung

#129802 / visualizzato 19374 volte
RABE di RABE
il 26 May 2011
rating-star 4
Applause
favorite
Preferito
report spam
Segnalare

Ohne Worte

Educazione e Tecnologia »  Science  Technology  School  Upbringing  University  Apprenticeship  Learning & Education  Hobby & Home

berufsorientierungberufswahlausbildungausbildungsplatzschuleunterrichtlehrerlehrerinschülerschülerinklassenraumklasseschultafelnagelnagelstudionagelbettnagelverlängerungnagellacknagelpflegekosmetikkosmetikstudiomädchenmanikürebildungsministeriumbildungsministerinschavanpisastudieschulsystemberufsorientierungberufswahlausbildungausbildungsplatzschuleunterrichtlehrerlehrerinklasseklassenraumschülerinschülerkosmetikstudiokosmetiknagelpflegenagellacknagelverlängerungmanikürebildunmädchenjobarbeit

Commenti (1)

 
Schoolpeppers
Member
Mit Grausen erinnere ich mich an meine eigene Berufsorientierung... Sehr schön, früh übt sich!

Schoolpeppers, il 27 May 2011  segnala post  rispondi applause 0

 
 

Aggiungi un commento
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Altro di RABE


Cartoon: Papst (small) by RABE tagged papst,benedikt,rücktritt,rom,vatikan,kirche,rabe,ralf,böhme,cartoon,karikatur,gott,herrgott,wolke,himmel,pontifikat,ratzinger,konsistorium,katholisch,glauben
Papst
Cartoon: Absturz (small) by RABE tagged absturz,weltwirtschaft,wirtschaftskrise,merkel,griechenland,schuldenkrise,esm,rettungsschirm,proteste,athen,samaras,konjunktur,extremsportler,absprung,baumgartner,rekordsprung,schallmauer,schallgrenze,fallschirm
Absturz
Cartoon: Retortenburger (small) by RABE tagged burger,retortenburger,gewebe,gewebezüchterei,metzgerei,metzger,fleischer,fleischerei,fleisch,enzyme,labor,wissenschaftler,reagenzglas,stammzellen,rinderstammzellen,fleischklops,niederlande,rabe,ralf,böhme,cartoon,karikatur,pressezeichnung,farbcartoon,wurs
Retortenburger
  • Service

  • ToonAgent
  • Aiuto
  • FAQ
  • Daily Toon
  • Informazioni generali

  • Informazioni generali
  • Contatti
  • Termini d'Uso
  • Politica della Privacy
  • Manage cookies
  • Community

  • Community
  • Cerca (Pro)
  • Collezioni
  • Registrati
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.