toonpool logo
  • Agent
  • Collezioni
  • altro
    • Community
    • Membri
    • Cerca (Pro)
    • Aiuto
  • accedi




    • Password lost?
  • Registrati
  • italiano
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Più recenti vignette
Cartoon: Blutbank (medium) by wista tagged blut,bank,blutbank,closed,open,banken,vampir,vampire,krank,krankenschwester,transfusion,bluttransfusion,operation,blutgruppe,spenden,blutspende,hospital,krankenhaus,eigenblut,eigenblutspende,arzt,ärzte,konserve,blutkonserve

Blutbank

#276071 / visualizzato 6885 volte
wista di wista
il 21 August 2016
rating-star 1
Applause
favorite
Preferito
report spam
Segnalare

2016

Educazione e Tecnologia »  Science  Research  Medical Engineering

blutbankblutbankclosedopenbankenvampirvampirekrankkrankenschwestertransfusionbluttransfusionoperationblutgruppespendenblutspendehospitalkrankenhauseigenbluteigenblutspendearztärztekonserveblutkonserve

Commenti (0)

Aggiungi un commento  
 

Altro di wista


Cartoon: Anti-AfD Demo (small) by wista tagged demo,demonstration,düsseldorf,anti,afd,rechts,rechtsextremismus,nazi,nazis,rheinturm,forum,remigration,mehrheit,schweigende,laut
Anti-AfD Demo
Cartoon: Spartipp (small) by wista tagged sparen,alltag,spartipp,spartipps,toilettenpapier,geld,einsparen,geiz,verbraucher,rabatt,sonderangebote,finanzen,einkommen,haushalt,haushaltsgeld,einkauf,einkaufen,supermark,discount,discounter
Spartipp
Cartoon: Coronafrösche (small) by wista tagged corona,covid,pandemie,maske,masken,ffp2,frosch,frösche,storch,essen,trinken,retaurant,test,testen,2g,3g,schutzmaske,kneipe,pcr,antigen
Coronafrösche
  • Service

  • ToonAgent
  • Aiuto
  • FAQ
  • Daily Toon
  • Informazioni generali

  • Informazioni generali
  • Contatti
  • Termini d'Uso
  • Politica della Privacy
  • Manage cookies
  • Community

  • Community
  • Cerca (Pro)
  • Collezioni
  • Registrati
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.