toonpool logo
  • Agent
  • Collezioni
  • altro
    • Community
    • Membri
    • Cerca (Pro)
    • Aiuto
  • accedi




    • Password lost?
  • Registrati
  • italiano
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Più recenti vignette
Cartoon: China und Taiwan (medium) by leopold maurer tagged chinas,raketen,treffen,meer,vor,taiwan,chinas,raketen,treffen,meer,vor,taiwan

China und Taiwan

#410311 / visualizzato 2846 volte
leopold maurer di leopold maurer
il 04 August 2022
rating-star 7
Applause
favorite
Preferito
report spam
Segnalare

...

Politica »  National/Domestic  International  Elections  Military & Security  Taxes  Third World  Terrorism  Finances  Pension  Economy & Money  Technology  Environment  Health  Family & Youth  Education  Confederations  Jobs & Social  Immigration  Fraud & Corruption  Historical  Other  Conflicts & War  Politicians  Parties  Privacy & Customer  Democracy  Energy

chinasraketentreffenmeervortaiwanchinasraketentreffenmeervortaiwan

Commenti (5)

 
Ago
Member
Wohl voller Anabolika*****

Ago, il 07 August 2022  segnala post  rispondi applause 0

 
Barthold
Member
solche Viecher hats früher massenhaft gegeben - sie sind alle ausgestorben

Barthold, il 05 August 2022  segnala post  rispondi applause 0

 
RABE
Member
Er will doch nur spülen!*****

RABE, il 04 August 2022  segnala post  rispondi applause 0

 
Erl
Member
Er will nur spielen lassen ...

Erl, il 04 August 2022  segnala post  rispondi applause 0

 
Harm Bengen
Member
ach, daher der name "drachenboot"!

Harm Bengen, il 04 August 2022  segnala post  rispondi applause 0

 
 

Aggiungi un commento
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Altro di leopold maurer


Cartoon: Deutschland gegen Spanien (small) by leopold maurer tagged wm,katar,2022,fussball,deutschland,spanien,unentschieden,eins,zu,boykott,boykottieren,brechen,gruppenspiel,aufstieg,möglichkeit,spiel,kinder,schlafzimmer,eltern,familie,leopold,maurer,karikatur,cartoon
Deutschland gegen Spanien
Cartoon: NASA-Sonde kracht in Asteroiden (small) by leopold maurer tagged nasa,sonde,asteroiden,einschlag,ablenken,klimawandel,krieg,dürre,überschwemmung,natur,katastrophe,klimaziel,artensterben,hunger,pandemie,virus,krankheit,austrocknung,ära,menschheit,rechtsruck,demokratie,diktatur,populismus,weltall,zerstörung,leopold,maurer,cartoon,karikatur
NASA-Sonde kracht in Asteroiden
Cartoon: Proteine für die EU (small) by leopold maurer tagged eu,nobelpreis,chemie,entwicklung,protein,demokratie,autokratie,orban,ungarn,komission,ukraine,hilfe,putin,krieg,sanktionen,migration,asyl,ratsvorsitz,leopold,maurer,karikatur,cartoon
Proteine für die EU
  • Service

  • ToonAgent
  • Aiuto
  • FAQ
  • Daily Toon
  • Informazioni generali

  • Informazioni generali
  • Contatti
  • Termini d'Uso
  • Politica della Privacy
  • Manage cookies
  • Community

  • Community
  • Cerca (Pro)
  • Collezioni
  • Registrati
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.