toonpool logo
  • Agent
  • Collezioni
  • altro
    • Community
    • Membri
    • Cerca (Pro)
    • Aiuto
  • accedi




    • Password lost?
  • Registrati
  • italiano
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Più recenti vignette
Cartoon: Ein Gespenst geht um in Katar (medium) by Erwin Pischel tagged fußball,weltmeisterschaft,world,cup,katar,qatar,infantino,ball,maskottchen,gespenst,korruption,fifa,finanzkapitalismus,fußballkapitalismus,gewinn,menschenrechte,sklaven,championship,protest,ausschluss,strafe,veranstalter,pischel,kommunistisches,manifest

Ein Gespenst geht um in Katar

#416139 / visualizzato 2195 volte
Erwin Pischel di Erwin Pischel
il 25 November 2022
rating-star 1
Applause
favorite
Preferito
report spam
Segnalare

-

Sport »  Soccer/Football  Ball Sports  Championships

fußballweltmeisterschaftworldcupkatarqatarinfantinoballmaskottchengespenstkorruptionfifafinanzkapitalismusfußballkapitalismusgewinnmenschenrechtesklavenchampionshipprotestausschlussstrafeveranstalterpischelkommunistischesmanifest

Commenti (2)

 
Erwin Pischel
Member
zenundsenf wrote:
du bist ein alter lehrer-fiesling!
(nur so am rande mal)

Verstehe ich nicht! Wieso nur am Rande?

Erwin Pischel, il 26 November 2022  segnala post  rispondi applause 0

 
zenundsenf
Member
du bist ein alter lehrer-fiesling!
(nur so am rande mal)

zenundsenf, il 26 November 2022  segnala post  rispondi applause 0

 
 

Aggiungi un commento

Altro di Erwin Pischel


Cartoon: Schlangen vor dt. Geldautomaten (small) by Erwin Pischel tagged bankautomat,finanzskandal,griechenland,snakes,queue,line,griechenlandkrise,krise,menschenschlange,schlange,kreuzotter,ringelnatter,kreditkarte,geldauszahlung,grexit,schulden,zahlungstermin,zahlungsfrist,staatsbankrott,staatspleite,geldautomat,pischel
Schlangen vor dt. Geldautomaten
Cartoon: Notopfer Corona Steuermarke (small) by Erwin Pischel tagged notopfer,briefmarke,corona,deutschland,postwertzeichen,postporto,porto,michelkatalog,postsendung,berlinblockade,berlin,blockade,westberlin,brief,postkarte,wirtschaft,not,verschuldung,staat,wirtschaftsministerium,sarc,covid,virus,spike,protein,pandemie,epidemie,schulden,staatsverschuldung,milliarden,euro,cent,pischel,kredit
Notopfer Corona Steuermarke
Cartoon: 2040 in the Supermarket (small) by Erwin Pischel tagged wasser,wein,flasche,preis,kosten,klimawandel,klima,klimakatastrophe,wüste,wüstenbildung,pischel
2040 in the Supermarket
  • Service

  • ToonAgent
  • Aiuto
  • FAQ
  • Daily Toon
  • Informazioni generali

  • Informazioni generali
  • Contatti
  • Termini d'Uso
  • Politica della Privacy
  • Manage cookies
  • Community

  • Community
  • Cerca (Pro)
  • Collezioni
  • Registrati
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2025 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.