toonpool logo
  • Agent
  • Collezioni
  • altro
    • Community
    • Membri
    • Cerca (Pro)
    • Aiuto
  • accedi




    • Password lost?
  • Registrati
  • italiano
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Più recenti vignette
Cartoon: Entwurmungsmittel (medium) by leopold maurer tagged entwurmungsmittel,pferde,ivermectin,fake,news,coronaleugner,impfverweigerer,querdenker,hirn,wurm,hirnlos,covid,sars,cov,entwurmungsmittel,pferde,ivermectin,fake,news,coronaleugner,impfverweigerer,querdenker,hirn,wurm,hirnlos,covid,sars,cov

Entwurmungsmittel

#394988 / visualizzato 3324 volte
leopold maurer di leopold maurer
il 19 November 2021
rating-star 5
Applause
favorite
Preferito
report spam
Segnalare

...

Politica »  National/Domestic  International  Health

entwurmungsmittelpferdeivermectinfakenewscoronaleugnerimpfverweigererquerdenkerhirnwurmhirnloscovidsarscoventwurmungsmittelpferdeivermectinfakenewscoronaleugnerimpfverweigererquerdenkerhirnwurmhirnloscovidsarscov

Commenti (6)

Aggiungi un commento  
Ago
Member
Da ist Hopfen und Malz verloren******

Ago, il 21 November 2021  segnala post  rispondi applause 0

 
Erl
Member
Es hat ihn halt so viel g´wurmt ...

Erl, il 19 November 2021  segnala post  rispondi applause 0

 
Chris Berger
Member
Ja, wenns der Kickl sagt...dann muss es stimmen.

Chris Berger, il 19 November 2021  segnala post  rispondi applause 0

 
Skowronek
Member
Da wirds selbst den Wurm zuviel.

Skowronek, il 19 November 2021  segnala post  rispondi applause 0

 
Barthold
Member
denkt das der Wurm?

Barthold, il 19 November 2021  segnala post  rispondi applause 0

 
Harm Bengen
Member
zum wiehern!

Harm Bengen, il 19 November 2021  segnala post  rispondi applause 0

 
 

Aggiungi un commento
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Altro di leopold maurer


Cartoon: Das letzte Triell (small) by leopold maurer tagged triell,wahlkampf,bundestagswahl,2021,kanzlerkanditat,scholz,laschet,baerbock,tv,diskussion,koalition,rot,grün,linke,opposition,cdu,csu,grüne,spd
Das letzte Triell
Cartoon: Proteine für die EU (small) by leopold maurer tagged eu,nobelpreis,chemie,entwicklung,protein,demokratie,autokratie,orban,ungarn,komission,ukraine,hilfe,putin,krieg,sanktionen,migration,asyl,ratsvorsitz,leopold,maurer,karikatur,cartoon
Proteine für die EU
Cartoon: Klimaanpassung (small) by leopold maurer tagged klima,klimaschutz,klimaschutzmassnahmen,weltklimakonferenz,erneuerbare,energie,fossile,gas,öl,sonne,wind,kohle,einigung,erderwärmung,katastrophen,fluten,hitze,überschwemmung,kälte,bewohnbar,anpassung,leopold,maurer,karikatur,cartoon
Klimaanpassung
  • Service

  • ToonAgent
  • Aiuto
  • FAQ
  • Daily Toon
  • Informazioni generali

  • Informazioni generali
  • Contatti
  • Termini d'Uso
  • Politica della Privacy
  • Manage cookies
  • Community

  • Community
  • Cerca (Pro)
  • Collezioni
  • Registrati
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.