toonpool logo
  • Agent
  • Collezioni
  • altro
    • Community
    • Membri
    • Cerca (Pro)
    • Aiuto
  • accedi




    • Password lost?
  • Registrati
  • italiano
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Più recenti vignette
Cartoon: Impftal (medium) by leopold maurer tagged impfgipfel,impfplan,merkel,bund,länder,impfung,corona,covid,treffen,mangel,impfgipfel,impfplan,merkel,bund,länder,impfung,corona,covid,treffen,mangel

Impftal

#376600 / visualizzato 2418 volte
leopold maurer di leopold maurer
il 01 February 2021
rating-star 5
Applause
favorite
Preferito
report spam
Segnalare

...

Politica »  National/Domestic  International  Health

impfgipfelimpfplanmerkelbundländerimpfungcoronacovidtreffenmangelimpfgipfelimpfplanmerkelbundländerimpfungcoronacovidtreffenmangel

Commenti (7)

Aggiungi un commento  
markus-grolik
Member
Alternativlos...

markus-grolik, il 02 February 2021  segnala post  rispondi applause 0

 
Guest Avatar
Deleted
...für all die Zombies da draußen, die geimpft werden wollen!

, il 01 February 2021  segnala post  rispondi applause 0

 
zenundsenf
Member
die schaffen das!

zenundsenf, il 01 February 2021  segnala post  rispondi applause 0

 
Erl
Member
:-)))))

Erl, il 01 February 2021  segnala post  rispondi applause 0

 
RABE
Member
An Worten nie verlegen!*****

RABE, il 01 February 2021  segnala post  rispondi applause 0

 
Harm Bengen
Member
"weniger ist mehr".

Harm Bengen, il 01 February 2021  segnala post  rispondi applause 0

 
Barthold
Member
ein Gesicht das nach akuter Suizidgefahr aussieht

Barthold, il 01 February 2021  segnala post  rispondi applause 0

 
 

Aggiungi un commento
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Altro di leopold maurer


Cartoon: Deutschland in der Krise (small) by leopold maurer tagged deutschland,krise,dfb,fussball,haushaltssperre,finanzen,schulden,ampel,regierung,gruene,spd,fdp,haushalt,cdu,csu,afd,umfragen,angst,oesterreich,leopold,maurer,cartoon,karikatur
Deutschland in der Krise
Cartoon: virtueller parteitag der CSU (small) by leopold maurer tagged parteitag,söder,bayern,kanzler,virtuell
virtueller parteitag der CSU
Cartoon: Omikron (small) by leopold maurer tagged virus,pandemie,corona,covid,sars,19,mutation,omikron,delta,ansteckend,schnell,protein,spike,rotkäppchen,impfung
Omikron
  • Service

  • ToonAgent
  • Aiuto
  • FAQ
  • Daily Toon
  • Informazioni generali

  • Informazioni generali
  • Contatti
  • Termini d'Uso
  • Politica della Privacy
  • Manage cookies
  • Community

  • Community
  • Cerca (Pro)
  • Collezioni
  • Registrati
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2025 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data ( e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

Necessary Cookies: These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
Personalisation Cookies: These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
Convenience Cookies: These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
Analysis Cookies: These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.