toonpool logo
  • Agent
  • Collezioni
  • altro
    • Community
    • Membri
    • Cerca (Pro)
    • Aiuto
  • accedi




    • Password lost?
  • Registrati
  • italiano
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Più recenti vignette
Cartoon: Real_work_for_Obama_now (medium) by firuzkutal tagged obama,usa,oil,election,firuz,kutal,iran,middle,east,afganistan,iraq,syria,kina

Real_work_for_Obama_now

#183993 / visualizzato 4214 volte
firuzkutal di firuzkutal
il 08 November 2012
rating-star 6
Applause
favorite
Preferito
report spam
Segnalare

Congratulations President Obama, but now the real work begins ..

Politica »  National/Domestic  International  Elections  Third World  Terrorism  Economy & Money  Technology  Environment  Conflicts & War  Politicians  Energy

obamausaoilelectionfiruzkutaliranmiddleeastafganistaniraqsyriakina

Commenti (2)

 
edda von sinnen
Member
klasse Cartoon! *****

edda von sinnen, il 09 November 2012  segnala post  rispondi applause 0

 
zenundsenf
Member
great work!
*****

zenundsenf, il 08 November 2012  segnala post  rispondi applause 1

 
 

Aggiungi un commento

Altro di firuzkutal


Cartoon: Traces of detergent residue (small) by firuzkutal tagged trump,detergent,usa,abd,war,middle,east,wash,dishes
Traces of detergent residue
Cartoon: YES_and_NO_referandum (small) by firuzkutal tagged referandum,turkey,yes,no,choice,vote,fruzkutal
YES_and_NO_referandum
Cartoon: World Cup 2018 gets a start (small) by firuzkutal tagged football,world,cup,russia,germany,italia,brasil,fair,play,soccer,fan,ball,game,holligan
World Cup 2018 gets a start
  • Service

  • ToonAgent
  • Aiuto
  • FAQ
  • Daily Toon
  • Informazioni generali

  • Informazioni generali
  • Contatti
  • Termini d'Uso
  • Politica della Privacy
  • Manage cookies
  • Community

  • Community
  • Cerca (Pro)
  • Collezioni
  • Registrati
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.