toonpool logo
  • Agent
  • Collezioni
  • altro
    • Community
    • Membri
    • Cerca (Pro)
    • Aiuto
  • accedi




    • Password lost?
  • Registrati
  • italiano
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Più recenti vignette
Cartoon: Steiniger Weg (medium) by Mirco Tomicek tagged messeranschlag,messerattacke,angriff,attacke,anschlag,solingen,sicherheit,wahlkampf,wahlkämpe,wahlen,wahl,landtagswahl,landtagswahlen,thüringen,sachsen,ampel,kolaition,ampelkoalition,regierung,umfrage,umfragewerte,steiniger,weg,karikatur,pressekarikatur,cartoon,mirco,tomicek,messeranschlag,messerattacke,angriff,attacke,anschlag,solingen,sicherheit,wahlkampf,wahlkämpe,wahlen,wahl,landtagswahl,landtagswahlen,thüringen,sachsen,ampel,kolaition,ampelkoalition,regierung,umfrage,umfragewerte,steiniger,weg,karikatur,pressekarikatur,cartoon,mirco,tomicek

Steiniger Weg

#449177 / visualizzato 1522 volte
Mirco Tomicek di Mirco Tomicek
il 27 August 2024
rating-star 0
Applause
favorite
Preferito
report spam
Segnalare

Der Messeranschlag in Solingen platzt in ohnehin aufgeheizte Wahlkämpfe in Sachsen und Thüringen.

Politica »  National/Domestic  International  Elections  Military & Security  Terrorism  Family & Youth  Education  Confederations  Jobs & Social  Other  Politicians  Parties  Privacy & Customer  Democracy

messeranschlagmesserattackeangriffattackeanschlagsolingensicherheitwahlkampfwahlkämpewahlenwahllandtagswahllandtagswahlenthüringensachsenampelkolaitionampelkoalitionregierungumfrageumfragewertesteinigerwegkarikaturpressekarikaturcartoonmircotomicekmesseranschlagmesserattackeangriffattackeanschlagsolingensicherheitwahlkampfwahlkämpewahlenwahllandtagswahllandtagswahlenthüringensachsenampelkolaitionampelkoalitionregierungumfrageumfragewertesteinigerwegkarikaturpressekarikaturcartoonmircotomicek

Commenti (0)

Aggiungi un commento  
 

Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Altro di Mirco Tomicek


Cartoon: Kanzlerfrage (small) by Mirco Tomicek tagged kanzlerfrage,besuch,in,bayern,angela,merkel,bundeskanzlerin,markus,söder,cdu,csu,schloss,herrenchiemsee,corona,covid19,gast,mit,kutsche,karikatur,mirco,tomicek,cartoon
Kanzlerfrage
Cartoon: Spitz auf Knopf (small) by Mirco Tomicek tagged sondersitzung,tierwohl,tier,wohl,tierschutz,tiere,schwein,schweine,kühe,kuh,schnitze,kompetenznetzwerk,bundesagrarministers,jochen,borchert,cdu,kommission,fleisch,wurst,preis,fleischpreis,bundeslandwirtschaftsministerin,tierprodukte,cartoon,karikatur,mirco,tomicek
Spitz auf Knopf
Cartoon: Fit For Ostern (small) by Mirco Tomicek tagged ostern,ostereiersuche,eiersuche,eier,ostereier,suche,osterhase,hase,eiweißpulver,eiweiß,protein,fit,fitness,sport,gym,kraftsport,training,whey,proteine,cartoon,karikatur,pressekarikatur,mirco,tomicek
Fit For Ostern
  • Service

  • ToonAgent
  • Aiuto
  • FAQ
  • Daily Toon
  • Informazioni generali

  • Informazioni generali
  • Contatti
  • Termini d'Uso
  • Politica della Privacy
  • Manage cookies
  • Community

  • Community
  • Cerca (Pro)
  • Collezioni
  • Registrati
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.