toonpool logo
  • Agent
  • Collezioni
  • altro
    • Community
    • Membri
    • Cerca (Pro)
    • Aiuto
  • accedi




    • Password lost?
  • Registrati
  • italiano
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » Più recenti vignette
Cartoon: Trump und Kuba (medium) by leopold maurer tagged trump,usa,präsident,krieg,venezuela,iran,kanada,kuba,grönland,aussenpolitik,innenpolitik,ablenkung,strategie,militär,macht,öl,schock,spritpreise,weltwirtschaft,zerstörer,kind,spiel,langeweile,epstein,files,midterm,wahlen,leopold,maurer,karikatur,cartoon,trump,usa,präsident,krieg,venezuela,iran,kanada,kuba,grönland,aussenpolitik,innenpolitik,ablenkung,strategie,militär,macht,öl,schock,spritpreise,weltwirtschaft,zerstörer,kind,spiel,langeweile,epstein,files,midterm,wahlen,leopold,maurer,karikatur,cartoon

Trump und Kuba

#480940 / visualizzato 1435 volte
leopold maurer di leopold maurer
il 17 March 2026
rating-star 10
Applause
favorite
Preferito
report spam
Segnalare

...

Politica »  National/Domestic  International

trumpusapräsidentkriegvenezuelairankanadakubagrönlandaussenpolitikinnenpolitikablenkungstrategiemilitärmachtölschockspritpreiseweltwirtschaftzerstörerkindspiellangeweileepsteinfilesmidtermwahlenleopoldmaurerkarikaturcartoontrumpusapräsidentkriegvenezuelairankanadakubagrönlandaussenpolitikinnenpolitikablenkungstrategiemilitärmachtölschockspritpreiseweltwirtschaftzerstörerkindspiellangeweileepsteinfilesmidtermwahlenleopoldmaurerkarikaturcartoon

Commenti (7)

Aggiungi un commento  
Harm Bengen
Member
wenn er wenigstens in der gummizelle spielen würde.

Harm Bengen, il 18 March 2026  segnala post  rispondi applause 0

 
omoko
Member
Sind so kleine Hände.

omoko, il 17 March 2026  segnala post  rispondi applause 0

 
markus-grolik
Member
Gamification

markus-grolik, il 17 March 2026  segnala post  rispondi applause 0

 
zenundsenf
Member
es geht auf ein seltsames grande finale zu!
(fragt sich für wen?)

zenundsenf, il 17 March 2026  segnala post  rispondi applause 0

 
Erl
Member
Der ist doch spielsüchtig!

Erl, il 17 March 2026  segnala post  rispondi applause 0

 
Barthold
Member
Bub, eindeutig Symptome von Wohlstandsverwahrlosung zeigend . . .

Barthold, il 17 March 2026  segnala post  rispondi applause 0

 
MorituruS
Member
Aus der Spielesammlung für Leute mit Aufmerksamkeitsdefizit und für Kinder unter 3 Jahren - auch geeignet für komplette Hornochsen.

MorituruS, il 17 March 2026  segnala post  rispondi applause 0

 
 

Aggiungi un commento
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Altro di leopold maurer


Cartoon: 35 Jahre Deutsche Einheit (small) by leopold maurer tagged tag,der,deutschen,einheit,deutschland,westen,osten,ddr,westdeutschland,mauerfall,paar,ehe,streitigkeiten,alte,muster,35,jahre,leopold,maurer,cartoon,karikatur
35 Jahre Deutsche Einheit
Cartoon: zum weinen (small) by leopold maurer tagged brangelina,breakingbrad,scheidung,trennung,angelina,jolie,brad,pitt,flüchtlingskrise,donald,trump,eu,krise,krieg,syrien,flüchtlinge,weltpolitik,paar,weinen,passant,nichtigkeit
zum weinen
Cartoon: Omikron (small) by leopold maurer tagged virus,pandemie,corona,covid,sars,19,mutation,omikron,delta,ansteckend,schnell,protein,spike,rotkäppchen,impfung
Omikron
  • Service

  • ToonAgent
  • Aiuto
  • FAQ
  • Daily Toon
  • Informazioni generali

  • Informazioni generali
  • Contatti
  • Termini d'Uso
  • Politica della Privacy
  • Manage cookies
  • Community

  • Community
  • Cerca (Pro)
  • Collezioni
  • Registrati
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.